"useSubjectIcons" : "true", }, Die Direkt-Aufladung über die Vodafone Webseite funktioniert nicht, habe es mit Kreditkarte, Klarna und auch Paypal versucht. ] { { "context" : "", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "action" : "rerender" "context" : "", "event" : "unapproveMessage", { }, "disallowZeroCount" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "actions" : [ "context" : "envParam:quiltName,message", "action" : "rerender" "actions" : [ ] { { { { } ] } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ { "disallowZeroCount" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); { "actions" : [ "disableKudosForAnonUser" : "false", "context" : "", LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } $(document).ready(function(){ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/CallYa/thread-id/83892","ajaxErrorEventName":"LITHIUM:ajaxError","token":"XIXwHaqegRQRLu3s8gB9gdxnThbPojcMuR3P0NJMFOk. //$('#vodafone-community-header').css('display','block'); { if ( !watching ) { $(event.data.selector).removeClass('cssmenu-open'); Wenn ich Probleme habe soll ich mich an Telekom Mobile wenden. "actions" : [ ] Execute whatever should happen when entering the right sequence "action" : "pulsate" "actions" : [ "context" : "envParam:quiltName", ] "event" : "AcceptSolutionAction", }, { } { "event" : "AcceptSolutionAction", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); ] // Oops. ] } Links finden Sie Ihr PayPal-Guthaben. "event" : "AcceptSolutionAction", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "event" : "addMessageUserEmailSubscription", "action" : "rerender" Ein manuelles Aufladen vom PayPal-Konto ist nicht nötig Loggen Sie sich als Erstes in Ihr PayPal ... MasterCard oder American Express. "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); "event" : "kudoEntity", "quiltName" : "ForumMessage", "message" : "2044362", } "context" : "", LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "rerender" } ;(function($) { LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_6d361001f0395a","nodesModel":{"CallYa|forum-board":{"title":"Board-Suche: CallYa","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: CallYa","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: CallYa","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_6d361001f0395a_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); }, }, { }); "context" : "", "context" : "", }, "actions" : [ "event" : "ProductAnswerComment", "event" : "MessagesWidgetAnswerForm", "parameters" : { { "actions" : [ { "useSubjectIcons" : "true", Bei den fehlerhaften Versuchen wollte ich 5 € aufladen. Mit Vodafone CallNow kann jeder Kunde sein Vodafone-Konto aufladen. "showCountOnly" : "false", "actions" : [ }, } "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_6d361001f0395a","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_6d361001f0395a_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/CallYa/thread-id/83892&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"8qpP4ZZtLfT2mY7byigJnJoTodgkIlHuQx3s1PwCjbU. // console.log('watching: ' + key); { { "event" : "MessagesWidgetEditAction", "revokeMode" : "true", // --> } "actions" : [ }, "context" : "", }, }, "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { ] }, "actions" : [ lithadmin: [] })(LITHIUM.jQuery); { "actions" : [ $(document).keydown(function(e) { "action" : "rerender" } "context" : "envParam:quiltName,message", "context" : "envParam:entity", { { ] { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "action" : "rerender" "truncateBodyRetainsHtml" : "false", ] { "actions" : [ ] "action" : "pulsate" LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ } { "useSimpleView" : "false", "actions" : [ "event" : "deleteMessage", "disableLabelLinks" : "false", "context" : "", }, "action" : "rerender" "truncateBody" : "true", "event" : "QuickReply", // Oops. "actions" : [ count = 0; }, "messageViewOptions" : "1111110111111111111110111110100101011101" ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "", } "action" : "rerender" "event" : "QuickReply", "actions" : [ } { { "context" : "", return; "triggerSelector" : ".lia-panel-dialog-trigger-event-click", Somit steht dir jederzeit das benötigte Guthaben zur freien Verfügung, damit du deine Vodafone CallYa Freikarte unbeschwert und unbegrenzt verwenden kannst. "entity" : "2044362", }, ], { "actions" : [ } "showCountOnly" : "false", "context" : "", "event" : "RevokeSolutionAction", "actions" : [ { "action" : "rerender" ctaHTML += "Lösung noch nicht gefunden? "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2044376,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "selector" : "#messageview_2", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", ] } } Wird das Guthaben auf Ihrer SIM-Karte von Lidl Connect knapp, sollten Sie es umgehend wieder aufladen. "event" : "MessagesWidgetEditAnswerForm", { ] { }); "actions" : [ "event" : "MessagesWidgetCommentForm", "actions" : [ $(document).ready(function() { "context" : "", ] }, } { "action" : "rerender" ] } "showCountOnly" : "false", "context" : "envParam:quiltName,message,product,contextId,contextUrl", No setup fees or hidden charges. } "event" : "approveMessage", "event" : "ProductMessageEdit", "actions" : [ { } $('.lia-autocomplete-footer').append(ctaHTML); "includeRepliesModerationState" : "false", var do_scroll = sessionStorage.is_scroll; } else { "actions" : [ ] }, { "event" : "removeThreadUserEmailSubscription", { "message" : "2044598", }); { { }, } }, "action" : "rerender" "linkDisabled" : "false" }, "action" : "rerender" "truncateBodyRetainsHtml" : "false", var clickedDomElement = $(this); $(document).ready(function(){ }; "eventActions" : [ } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2044598 .lia-rating-control-passive', '#form_2'); "action" : "rerender" { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "quiltName" : "ForumMessage", { ] $(this).next().toggle(); $('.css-menu').removeClass('cssmenu-open') LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "componentId" : "forums.widget.message-view", { LITHIUM.Dialog.options['-1466823159'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] } "componentId" : "kudos.widget.button", ] "action" : "rerender" { "context" : "", { "actions" : [ // console.log(key); { LITHIUM.AjaxSupport.ComponentEvents.set({ } } return; LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2044598,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. count = 0; "event" : "MessagesWidgetMessageEdit", "event" : "addMessageUserEmailSubscription", }, }, "kudosable" : "true", //resetMenu(); }, } }, "buttonDialogCloseAlt" : "Schließen", "action" : "rerender" { "action" : "rerender" var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "displaySubject" : "true", ] { "initiatorBinding" : true, // console.log(key); "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "", ] "actions" : [ // enable redirect to login page when "logmein" is typed into the void =) }, Es gibt drei unterschiedliche Pakete, die Sie auswählen können. "event" : "addMessageUserEmailSubscription", } if ( count == neededkeys.length ) { "action" : "rerender" }, }, "}); "action" : "rerender" { "context" : "", DTMS: ungerechtfertigte Abbuch... SIM karte wird in zukunft nicht mehr unterstützt, Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_6d361001f0395a_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/CallYa/thread-id/83892&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "event" : "MessagesWidgetMessageEdit", }, "actions" : [ "action" : "rerender" ] "action" : "rerender" } ] "actions" : [ Skip to main content Skip to search PayPal Home. PayPal, plus pay later options. }, { }, "event" : "kudoEntity", ] "dialogContentCssClass" : "lia-panel-dialog-content", "componentId" : "forums.widget.message-view", "action" : "rerender" "action" : "rerender" // just for convenience, you need a login anyways... "initiatorBinding" : true, ] "event" : "markAsSpamWithoutRedirect", } $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); ], Das ist schade, denn CallYa bietet Ihnen viele Vorteile: Keine Vertragsbindung, volle Kostenkontrolle und mit dem CallYa-Comfort vor allem sehr günstige Gesprächspreise. { "action" : "rerender" PayPal’s Customer Service hours will change during the holiday season. ] } "actions" : [ "context" : "envParam:quiltName", LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "revokeMode" : "true", "defaultAriaLabel" : "", "context" : "", "}); Create your link and share it so customers can pay you directly. "actions" : [ "event" : "MessagesWidgetMessageEdit", "useTruncatedSubject" : "true", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234526}); "context" : "envParam:quiltName", "action" : "addClassName" }, "initiatorBinding" : true, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "action" : "rerender" "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "pulsate" ', 'ajax'); Oder wenn es nicht mehr für den Basispreis Deines Tarifs oder Deine Tarifoptionen ausreicht. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" return; LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234526}); }, "event" : "addMessageUserEmailSubscription", "action" : "rerender" ] "context" : "lia-deleted-state", "event" : "removeMessageUserEmailSubscription", "actions" : [ "accessibility" : false, "action" : "rerender" "context" : "", { LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { } "action" : "rerender" "includeRepliesModerationState" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/CallYa/thread-id/83892","ajaxErrorEventName":"LITHIUM:ajaxError","token":"XIXwHaqegRQRLu3s8gB9gdxnThbPojcMuR3P0NJMFOk. "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } } "event" : "MessagesWidgetEditAction", } "action" : "addClassName" "event" : "removeMessageUserEmailSubscription", "context" : "", "actions" : [ "parameters" : { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { { "action" : "rerender" "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", { ] "action" : "rerender" { "closeEvent" : "LITHIUM:lightboxCloseEvent", } ] "truncateBody" : "true", "event" : "addMessageUserEmailSubscription", ] "event" : "ProductMessageEdit", if ( watching ) { { } ] })(LITHIUM.jQuery); "action" : "rerender" "event" : "editProductMessage", "}); A Netflix gift card is a great choice when you want to give the gift of Netflix, or if you prefer to use cash to prepay your own subscription.. You can purchase Netflix gift cards at select retailers.. You can redeem multiple gift cards on your account.